Web stats for Resellerflipkartdailydhamaka - resellerflipkartdailydhamaka.info
4.38 Rating by ClearWebStats
resellerflipkartdailydhamaka.info is 5 years 3 months 1 week old. This website has a #8,044,772 rank in global traffic. It has a .info as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, resellerflipkartdailydhamaka.info is SAFE to browse.
Traffic Report of Resellerflipkartdailydhamaka
| Daily Unique Visitors: | 60 |
| Daily Pageviews: | 120 |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | 8,044,772 |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is resellerflipkartdailydhamaka.info server located?
Hosted IP Address:
104.219.232.58
Hosted Country:
US
Location Latitude:
40.9755Location Longitude:
-73.6909Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.219.232.58)
HTTP Header Analysis
HTTP/1.1 200 OK
Connection: Keep-Alive
Content-Type: text/html
Transfer-Encoding: chunked
Content-Encoding: br
Vary: Accept-Encoding
Date: Wed, 04 Dec 2019 21:22:02 GMT
Connection: Keep-Alive
Content-Type: text/html
Transfer-Encoding: chunked
Content-Encoding: br
Vary: Accept-Encoding
Date: Wed, 04 Dec 2019 21:22:02 GMT
Domain Information for resellerflipkartdailydhamaka.info
| Domain Registrar: |
Afilias Global Registry Services
|
|---|---|
| Registration Date: | 2019-01-12 5 years 3 months 1 week ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.shared-host.in |
|
104.219.232.61 |
United States
|
| ns2.shared-host.in |
|
104.219.232.62 |
United States
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| resellerflipkartdailydhamaka.info | A | 14399 |
IP:104.219.232.58 |
| resellerflipkartdailydhamaka.info | NS | 21599 |
Target:ns2.shared-host.in |
| resellerflipkartdailydhamaka.info | NS | 21599 |
Target:ns1.shared-host.in |
| resellerflipkartdailydhamaka.info | SOA | 21599 |
MNAME:ns1.shared-host.in RNAME:hostleloserver.gmail.com Serial:2019120101 Refresh:3600 Retry:1800 Expire:1209600 |
| resellerflipkartdailydhamaka.info | MX | 14399 |
Target:resellerflipkartdailydhamaka.info |
| resellerflipkartdailydhamaka.info | TXT | 14399 |
TXT:v=spf1 +a +mx +ip4:104.219.232.58 ~all |
Similarly Ranked Websites to Resellerflipkartdailydhamaka
Порно засунул голову в пизду - www.dproxi.ru
Бесплатное на этом секс порно портале online 720p
8,044,774 
$ 8.95
أراثÙ٠ز - Ù ÙÙع عرب٠ÙÙÙÙاÙب اÙ٠جاÙÙØ© اÙجاÙزة ÙÙتØÙ ÙÙ
Ù ÙÙع عرب٠ÙÙÙÙاÙب اÙعربÙØ© اÙ٠جاÙÙØ© اÙت٠ÙÙ Ù٠استخدا٠Ùا ÙÙÙ ÙاÙع اÙاخبارÙØ© ÙاÙ٠جÙات اÙاÙÙترÙÙÙØ© ÙÙ ÙاÙع اÙسÙرة اÙذاتÙØ© ÙاÙ٠دÙÙات اÙشخصÙØ© تØت رخصة اÙ٠شاع اÙابداعÙ.
8,044,780 $ 8.95
Aστρολογία-Παραδοσιακή Χαρτομαντεία της Προύσσας – ΑΣΤΡΟΛΟΓΙΑ-ΧΑΡΤΟΜΑΝΤΕΙΑ-ΠΡΟΒΛΕΨΕΙΣ-ΑΡΘΡΑ
Πρόσφυγες από την Προύσσα οι πρόγονοί μου έφεραν μαζί τους εκτός από μνήμες και παραδόσεις!! Μια από αυτές ήταν και η παραδοσιακή χαρτομαντεία της Προύσσας με γοήτευσε γιατί ήταν έναν κομμάτι από τις ρίζες μου αλλά και για τη δύναμη που είχαν οι προβλέψεις της.Μια μέθοδο μοναδική ,που όπως διαπίστωσα ελάχιστοι γνώριζαν την ανάλυση και…
8,044,784 $ 8.95
Alan Raga | Wellington wedding photographer | Fashion photographer| Family portrait |
Wellington Photographer ,Wellington wedding photographer, alan raga photography, Wellington portrait, corporate portrait, wellington wedding, professional photographer, alanraga.com, wedding service supplier, head shot photographer, fashion photographer
8,044,791 $ 8.95
Full WHOIS Lookup for resellerflipkartdailydhamaka.info
Domain Name: RESELLERFLIPKARTDAILYDHAMAKA.INFO
Registry Domain ID: D503300001182459774-LRMS
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: http://publicdomainregistry.com/whois
Updated Date: 2019-12-01T07:52:13Z
Creation Date: 2019-12-01T07:08:54Z
Registry Expiry Date: 2020-12-01T07:08:54Z
Registrar Registration Expiration Date:
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registrant Organization: N/A
Registrant State/Province: Delhi
Registrant Country: IN
Name Server: NS1.SHARED-HOST.IN
Name Server: NS2.SHARED-HOST.IN
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form is https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2019-12-04T21:21:03Z
Registry Domain ID: D503300001182459774-LRMS
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: http://publicdomainregistry.com/whois
Updated Date: 2019-12-01T07:52:13Z
Creation Date: 2019-12-01T07:08:54Z
Registry Expiry Date: 2020-12-01T07:08:54Z
Registrar Registration Expiration Date:
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registrant Organization: N/A
Registrant State/Province: Delhi
Registrant Country: IN
Name Server: NS1.SHARED-HOST.IN
Name Server: NS2.SHARED-HOST.IN
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form is https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2019-12-04T21:21:03Z